Recombinant P. aeruginosa piv Protein, His-SUMO-tagged
Cat.No. : | piv-1341P |
Product Overview : | Recombinant B. pertussis piv Protein (212-462aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | P.aeruginosa |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 212-462 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 42.4 kDa |
AA Sequence : | AGYRDGFGASGSCEVDAVCATQSGTRAYDNATAAVAKMVFTSSADGGSYICTGTLLNNGNSPKRQLFWSA AHCIEDQATAATLQTIWFYNTTQCYGDASTINQSVTVLTGGANILHRDAKRDTLLLELKRTPPAGVFYQG WSATPIANGSLGHDIHHPRGDAKKYSQGNVSAVGVTYDGHTALTRVDWPSAVVEGGSSGSGLLTVAGDGS YQLRGGLYGGPSYCGAPTSQRNDYFSDFSGVYSQISRYFAP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | piv endopeptidase IV [ Pseudomonas aeruginosa PAO1 ] |
Official Symbol | piv |
Synonyms | prpL; piv; Lysyl endopeptidase; EC 3.4.21.50; Protease IV; PvdS-regulated endoprotease |
Gene ID | 880208 |
Protein Refseq | NP_252864.1 |
UniProt ID | Q9HWK6 |
◆ Recombinant Proteins | ||
SGSH-695H | Recombinant Human SGSH Protein, His/GST-tagged | +Inquiry |
MBL2-1453H | Recombinant Human MBL2 Protein (21-248 aa), His-tagged | +Inquiry |
Angpt2-5309M | Recombinant Mouse Angpt2 protein, His-tagged | +Inquiry |
PSMD5-568C | Recombinant Cynomolgus Monkey PSMD5 Protein, His (Fc)-Avi-tagged | +Inquiry |
BAZ2B-100H | Recombinant Human BAZ2B Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CDA002 | Active Native Human MUC16 Protein | +Inquiry |
ighg1-160M | Native Mouse Immunoglobulin G1 | +Inquiry |
RO60-16C | Native Cattle RO60 Protein, Biotinlyated | +Inquiry |
SERPINA3-8349H | Native Human SERPINA3 | +Inquiry |
Collagen-01B | Native Bovine Type II Collagen | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM55-1830HCL | Recombinant Human TRIM55 cell lysate | +Inquiry |
CBY1-147HCL | Recombinant Human CBY1 lysate | +Inquiry |
MEF2C-4375HCL | Recombinant Human MEF2C 293 Cell Lysate | +Inquiry |
RBCK1-2486HCL | Recombinant Human RBCK1 293 Cell Lysate | +Inquiry |
TMEM139-675HCL | Recombinant Human TMEM139 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All piv Products
Required fields are marked with *
My Review for All piv Products
Required fields are marked with *
0
Inquiry Basket