Recombinant P. aeruginosa ampC Protein, His-SUMO-tagged

• Cat.No.: ampC-1119P
• Product Overview: Recombinant Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) ampC Protein (27-397aa) was expressed in E. coli with N-terminal His-SUMO-tag.

Specification

• Species: P.aeruginosa
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 27-397 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 56.7 kDa
• AA Sequence: GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Publications:
  Multiplexed screen identifies a Pseudomonas aeruginosa-specific small molecule targeting the outer membrane protein OprH and its interaction with LPS (2024)

Gene Information

• Gene Name: ampC beta-lactamase [ Pseudomonas aeruginosa PAO1 ]
• Official Symbol: ampC
• Synonyms: Beta-lactamase; ampC; EC= 3.5.2.6; Cephalosporinase
• Gene ID: 878149
• Protein Refseq: NP_252799.1
• UniProt ID: P24735