Recombinant Norovirus ORF2 Protein, His-tagged

Cat.No. : ORF2-30N
Product Overview : Recombinant Norovirus ORF2 Protein, fused to His-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Norovirus
Source : E.coli
Tag : His
Description : VP1
Form : Supplied as a 0.2 μm filtered solution in 50mM Tris, 300mM NaCl, 2M urea, pH 8.0.
Molecular Mass : 36.3 kDa
AA Sequence : MHHHHHHSKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTTQLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFGIISQRDRHNSPGHNEPANRGHDTVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFTPVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGSPAIDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAPVVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1 mg/ml
Gene Name ORF2 VP1 [ Norovirus GV ]
Official Symbol ORF2
Gene ID 4246736
Protein Refseq YP_720002
UniProt ID Q83884

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ORF2 Products

Required fields are marked with *

My Review for All ORF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon