Recombinant Norovirus ORF2 Protein, His-tagged
Cat.No. : | ORF2-30N |
Product Overview : | Recombinant Norovirus ORF2 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Norovirus |
Source : | E.coli |
Tag : | His |
Description : | VP1 |
Form : | Supplied as a 0.2 μm filtered solution in 50mM Tris, 300mM NaCl, 2M urea, pH 8.0. |
Molecular Mass : | 36.3 kDa |
AA Sequence : | MHHHHHHSKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTTQLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFGIISQRDRHNSPGHNEPANRGHDTVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFTPVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGSPAIDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAPVVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1 mg/ml |
Gene Name | ORF2 VP1 [ Norovirus GV ] |
Official Symbol | ORF2 |
Gene ID | 4246736 |
Protein Refseq | YP_720002 |
UniProt ID | Q83884 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ORF2 Products
Required fields are marked with *
My Review for All ORF2 Products
Required fields are marked with *
0
Inquiry Basket