Recombinant Neurospora Crassa NCU05495 Protein (1-111 aa), His-tagged

• Cat.No.: NCU05495-2431N
• Product Overview: Recombinant Neurospora Crassa (strain ATCC 24698/74-OR23-1A/CBS 708.71/DSM 1257/FGSC 987) NCU05495 Protein (1-111 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Neurospora Crassa
• Source: E.coli
• Tag: His
• Protein Length: 1-111 aa
• Description: Mannose-binding lectin.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 16.9 kDa
• AA Sequence: MSFHVTAEDARIEVRDNRTILFARLRREDGEWNDASYELDQIIGNNDGHFQWGGQNFTETAEDIRFHPKEGAAEQPILRARLRDCNGEFHDRDVNLTEIVENVNGEFQAKF
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: NCU05495
• UniProt ID: Q7S6U4