Recombinant Neisseria Meningitidis Serogroup B/Serotype 15 PORB Protein (20-331 aa), His-SUMO-tagged

Cat.No. : PORB-2094N
Product Overview : Recombinant Neisseria Meningitidis Serogroup B/Serotype 15 (strain H44/76)) PORB Protein (20-331 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Neisseria Meningitidis Serogroup B/Serotype 15
Source : E.coli
Tag : His&SUMO
Protein Length : 20-331 aa
Description : Serves as a slightly cation selective porin.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 49.8 kDa
AA Sequence : DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGLVDDADIGNEYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVATAGGVGLRHKF
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name porB major outer membrane protein PIB [ Neisseria meningitidis MC58 ]
Official Symbol PORB
Synonyms porB; Class 3 protein Porin;
Gene ID 904054
UniProt ID E6MZM0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PORB Products

Required fields are marked with *

My Review for All PORB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon