Recombinant Neisseria Meningitidis Serogroup B/Serotype 15 PORB Protein (20-331 aa), His-SUMO-tagged

• Cat.No.: PORB-2094N
• Product Overview: Recombinant Neisseria Meningitidis Serogroup B/Serotype 15 (strain H44/76)) PORB Protein (20-331 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.

Specification

• Species: Neisseria Meningitidis Serogroup B/Serotype 15
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 20-331 aa
• Description: Serves as a slightly cation selective porin.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 49.8 kDa
• AA Sequence: DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGLVDDADIGNEYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVATAGGVGLRHKF
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: porB major outer membrane protein PIB [ Neisseria meningitidis MC58 ]
• Official Symbol: PORB
• Synonyms: porB; Class 3 protein Porin
• Gene ID: 904054
• UniProt ID: E6MZM0