Recombinant N. meningitidis ponA Protein, His-SUMO-tagged
Cat.No. : | ponA-1287N |
Product Overview : | Recombinant Neisseria meningitidis serogroup B (strain MC58) ponA Protein (206-413aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | N.meningitidis |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 206-413 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 40.0 kDa |
AA Sequence : | KAPSAYNPIVNPERAKLRQKYILNNMLEEKMITVQQRDQALNEELHYERFVRKIDQSALYVAEMVRQELY EKYGEDAYTQGFKVYTTVRADHQKVATEALRKALRNFDRGSSYRGAENYIDLSKSEDVEETVSQYLSGLY TVDKMVPAVVLDVTKKKNVVIQLPGGRRVTLDRRALGFAARAVNNEKMGEDRIRRGAVIRVKNNGGRW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | ponA penicillin-binding protein 1 [ Neisseria meningitidis MC58 ] |
Official Symbol | ponA |
Synonyms | ponA |
Gene ID | 903291 |
Protein Refseq | NP_274804.1 |
UniProt ID | P0A0Z6 |
◆ Native Proteins | ||
REN-245H | Active Native Human Renin | +Inquiry |
LAMA-69M | Native Mouse Laminin protein | +Inquiry |
CDA015 | Native Hepatitis B Surface Ag protein | +Inquiry |
FSH-1565S | Active Native Sheep Stimulating Hormone | +Inquiry |
GABase-01P | Native Pseudomonas fluorescens γ-aminobutyric acid amino transferase, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENO3-248HCL | Recombinant Human ENO3 lysate | +Inquiry |
LRRTM3-4616HCL | Recombinant Human LRRTM3 293 Cell Lysate | +Inquiry |
ACOT8-9086HCL | Recombinant Human ACOT8 293 Cell Lysate | +Inquiry |
TMEM134-1004HCL | Recombinant Human TMEM134 293 Cell Lysate | +Inquiry |
FRS2-6134HCL | Recombinant Human FRS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ponA Products
Required fields are marked with *
My Review for All ponA Products
Required fields are marked with *
0
Inquiry Basket