Recombinant N. meningitidis Major outer membrane protein P.IB Protein, His-SUMO-tagged

• Cat.No.: porB-1337N
• Product Overview: Recombinant N. meningitidis serogroup B Major outer membrane protein P.IB Protein (20-331aa) was expressed in E. coli with N-terminal His-SUMO tag.

Specification

• Species: N.meningitidis
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 20-331 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 49.8 kDa
• AA Sequence: DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGLVDDADIGNEYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVATAGGVGLRHKF
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: Major outer membrane protein P.IB
• Official Symbol: Major outer membrane protein P.IB
• Synonyms: Major outer membrane protein P.IB; porB; Protein IB; PIB; Class 3 protein; Porin
• UniProt ID: E6MZM0