Recombinant Mycoplasma Pneumoniae LON Protein (1-206 aa), His-SUMO-tagged

• Cat.No.: LON-2009M
• Product Overview: Recombinant Mycoplasma Pneumoniae (strain ATCC 29342/M129) LON Protein (1-206 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.

Specification

• Description: ATP-dependent serine protease that mediates the selective degradation of mutant and abnormal proteins as well as certain short-lived regulatory proteins. Required for cellular homeostasis and for survival from DNA damage and developmental changes induced by stress. Degrades polypeptides processively to yield small peptide fragments that are 5 to 10 amino acids long. Binds to DNA in a double-stranded, site-specific manner.
• Source: E. coli
• Species: Mycoplasma Pneumoniae
• Tag: His&SUMO
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 39.8 kDa
• Protein length: 1-206 aa
• AA Sequence: MPAVKKPQILVVRNQVIFPYNGFELDVGRERSKKLIKALKNLKTKRLVLVTQKNSDQLNPEFDDIYHCGTLCDIDEIIEVPSEDGKTADYKIKGKGLQRVAITSFSDADLTKYDHHFLNSTLTENKALDKLLERIFPDKEDFAEILDSLNSFLELQELKKLSKVPKDIKRYDIITFKLASLIFKDITLQQAILEENDIEKRLQKII
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: lon Lon protease [ Mycoplasma pneumoniae M129 ]
• Official Symbol: LON
• Synonyms: lon; F10_orf795
• Gene ID: 877195
• Protein Refseq: NP_110020
• UniProt ID: P78025