Recombinant Mycoplasma Pneumoniae LON Protein (1-206 aa), His-SUMO-tagged
Cat.No. : | LON-2009M |
Product Overview : | Recombinant Mycoplasma Pneumoniae (strain ATCC 29342/M129) LON Protein (1-206 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma Pneumoniae |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-206 aa |
Description : | ATP-dependent serine protease that mediates the selective degradation of mutant and abnormal proteins as well as certain short-lived regulatory proteins. Required for cellular homeostasis and for survival from DNA damage and developmental changes induced by stress. Degrades polypeptides processively to yield small peptide fragments that are 5 to 10 amino acids long. Binds to DNA in a double-stranded, site-specific manner. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 39.8 kDa |
AA Sequence : | MPAVKKPQILVVRNQVIFPYNGFELDVGRERSKKLIKALKNLKTKRLVLVTQKNSDQLNPEFDDIYHCGTLCDIDEIIEVPSEDGKTADYKIKGKGLQRVAITSFSDADLTKYDHHFLNSTLTENKALDKLLERIFPDKEDFAEILDSLNSFLELQELKKLSKVPKDIKRYDIITFKLASLIFKDITLQQAILEENDIEKRLQKII |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | lon Lon protease [ Mycoplasma pneumoniae M129 ] |
Official Symbol | LON |
Synonyms | lon; F10_orf795; |
Gene ID | 877195 |
Protein Refseq | NP_110020 |
UniProt ID | P78025 |
◆ Recombinant Proteins | ||
lon-90E | Recombinant E.coli Lon Protease, His-tagged | +Inquiry |
LON-2009M | Recombinant Mycoplasma Pneumoniae LON Protein (1-206 aa), His-SUMO-tagged | +Inquiry |
lon-0836E | Recombinant E. coli (strain K12) lon Protein (Asn2-Lys784), C-His tagged | +Inquiry |
lon-214E | Recombinant E. coli lon protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LON Products
Required fields are marked with *
My Review for All LON Products
Required fields are marked with *
0
Inquiry Basket