Recombinant Mycobacterium Tuberculosis RELG Protein (1-87 aa), His-SUMO-tagged

• Cat.No.: RELG-2216M
• Product Overview: Recombinant Mycobacterium Tuberculosis (strain ATCC 25618/H37Rv) RELG Protein (1-87 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Mycobacterium Tuberculosis
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 1-87 aa
• Description: Toxic component of a toxin-antitoxin (TA) module. Has RNase activity and preferentially cleaves at the 3'-end of purine ribonucleotides. Overexpression in M.tuberculosis or M.smegmatis inhibits colony formation in a bacteriostatic rather than bacteriocidal fashion. Its toxic effect is neutralized by coexpression with cognate antitoxin RelB2 (shown only for M.smegmatis). Overexpression also increases the number of gentamicin-tolerant and levofloxacin-tolerant persister cells.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 26.2 kDa
• AA Sequence: MPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDHRADIYRR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: relG toxin RelG [ Mycobacterium tuberculosis H37Rv ]
• Official Symbol: RELG
• Synonyms: relG; Putative endoribonuclease RelG; relE2
• Gene ID: 887450
• Protein Refseq: NP_217382
• UniProt ID: O33348