Recombinant Mycobacterium Tuberculosis PSTS1 Protein (24-373 aa), His-tagged

• Cat.No.: PSTS1-1280M
• Product Overview: Recombinant Mycobacterium Tuberculosis (strain CDC 1551/Oshkosh) PSTS1 Protein (24-373 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Mycobacterium Tuberculosis
• Source: E.coli
• Tag: His
• ProteinLength: 24-373 aa
• Description: Part of the ABC transporter complex PstSACB involved in phosphate import.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 39.8 kDa
• AA Sequence: CGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPAVVKLSDALIATIS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: pstS1; Antigen Ag78 Protein antigen B Short name: PAB
• UniProt ID: P9WGU0