Recombinant Mycobacterium Tuberculosis LEPB Protein (88-294 aa), His-tagged

• Cat.No.: LEPB-1649M
• Product Overview: Recombinant Mycobacterium Tuberculosis (strain ATCC 25618/H37Rv) LEPB Protein (88-294 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Mycobacterium Tuberculosis
• Source: Yeast
• Tag: His
• ProteinLength: 88-294 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 24.6 kDa
• AA Sequence: RPYLIPSESMEPTLHGCSTCVGDRIMVDKLSYRFGSPQPGDVIVFRGPPSWNVGYKSIRSHNVAVRWVQNALSFIGFVPPDENDLVKRVIAVGGQTVQCRSDTGLTVNGRPLKEPYLDPATMMADPSIYPCLGSEFGPVTVPPGRVWVMGDNRTHSADSRAHCPLLCTDDPLPGTVPVANVIGKARLIVWPPSRWGVVRSVNPQQGR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: lepB signal peptidase [ Mycobacterium tuberculosis H37Rv ]
• Official Symbol: LEPB
• Synonyms: lepB; Leader peptidase I
• Gene ID: 887157
• Protein Refseq: NP_217419
• UniProt ID: P9WKA1