Recombinant Mycobacterium Tuberculosis HRP1 Protein (1-143 aa), His-SUMO-Myc-tagged

• Cat.No.: HRP1-2199M
• Product Overview: Recombinant Mycobacterium Tuberculosis (strain ATCC 25618/H37Rv) HRP1 Protein (1-143 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length.

Specification

• Species: Mycobacterium Tuberculosis
• Source: E.coli
• Tag: His&Myc&SUMO
• Protein Length: 1-143 aa
• Description: Unlike some other CBS-domain containing proteins does not seem to bind AMP.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 35.5 kDa
• AA Sequence: MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: hrp1 hypoxic response protein [ Mycobacterium tuberculosis H37Rv ]
• Official Symbol: HRP1
• Synonyms: hrp1
• Gene ID: 888576
• Protein Refseq: NP_217142
• UniProt ID: P9WJA3