Recombinant Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) hspX protein, His-tagged

• Cat.No.: hspX-2290M
• Product Overview: Recombinant Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) hspX protein(P0A5B8)(2-144aa), fused to C-terminal His tag, was expressed in Insect Cell.

Specification

• Species: Mycobacterium Bovis
• Source: Insect Cells
• Tag: His
• ProteinLength: 2-144aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18.1 kDa
• AA Sequence: ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.