Recombinant Mouse Wnt8b Protein, His-SUMO/MYC-tagged
Cat.No. : | Wnt8b-1051M |
Product Overview : | Recombinant Mouse Wnt8b Protein (2-350aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc&SUMO |
ProteinLength : | 2-350 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 56.2 kDa |
AA Sequence : | WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Wnt8b wingless-type MMTV integration site family, member 8B [ Mus musculus (house mouse) ] |
Official Symbol | Wnt8b |
Synonyms | Wnt8b |
Gene ID | 22423 |
mRNA Refseq | NM_011720.3 |
Protein Refseq | NP_035850.2 |
UniProt ID | Q9WUD6 |
◆ Native Proteins | ||
HP-26196TH | Native Human HP | +Inquiry |
Acta1-158M | Native Mouse skeletal muscle alpha Actin | +Inquiry |
DAO1-25P | Active Native Porcine D-Amino acid oxidase | +Inquiry |
BSA-01 | Native Bovine Serum Albumin | +Inquiry |
LN-2686M | Native Mouse LN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPTSSB-8041HCL | Recombinant Human C3orf57 293 Cell Lysate | +Inquiry |
GTDC1-5706HCL | Recombinant Human GTDC1 293 Cell Lysate | +Inquiry |
EPC1-566HCL | Recombinant Human EPC1 cell lysate | +Inquiry |
Spleen-775C | Chicken Spleen Membrane Lysate, Total Protein | +Inquiry |
HIST1H1C-5553HCL | Recombinant Human HIST1H1C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Wnt8b Products
Required fields are marked with *
My Review for All Wnt8b Products
Required fields are marked with *
0
Inquiry Basket