Recombinant Mouse Wnt8b Protein, His-SUMO/MYC-tagged
Cat.No. : | Wnt8b-1051M |
Product Overview : | Recombinant Mouse Wnt8b Protein (2-350aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 2-350 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 56.2 kDa |
AA Sequence : | WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Wnt8b wingless-type MMTV integration site family, member 8B [ Mus musculus (house mouse) ] |
Official Symbol | Wnt8b |
Synonyms | Wnt8b |
Gene ID | 22423 |
mRNA Refseq | NM_011720.3 |
Protein Refseq | NP_035850.2 |
UniProt ID | Q9WUD6 |
◆ Recombinant Proteins | ||
WNT8B-210H | Recombinant Human WNT8B, StrepII-tagged | +Inquiry |
Wnt8b-4960M | Recombinant Mouse Wnt8b protein, His-SUMO & Myc-tagged | +Inquiry |
Wnt8b-1051M | Recombinant Mouse Wnt8b Protein, His-SUMO/MYC-tagged | +Inquiry |
WNT8B-3741H | Recombinant Human WNT8B, GST-tagged | +Inquiry |
WNT8B-8596Z | Recombinant Zebrafish WNT8B | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT8B-286HCL | Recombinant Human WNT8B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Wnt8b Products
Required fields are marked with *
My Review for All Wnt8b Products
Required fields are marked with *
0
Inquiry Basket