Recombinant Mouse Wif1 Protein, His-tagged

• Cat.No.: Wif1-7382M
• Product Overview: Recombinant Mouse Wif1 protein with a His tag was expressed in insect cells.

Specification

• Description: Binds to WNT proteins and inhibits their activities. May be involved in mesoderm segmentation.
• Source: Insect cell
• Species: Mouse
• Tag: His
• Form: Liquid
• Molecular Mass: 39.4 kDa
• Protein length: 29-379
• AA Sequence: GQPPEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIVMNSEGNTILRTPQNAIFFKTCQQAECPGGCRNGGFCNERRVCECPDGFYGPHCEKALCIPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCELSKCPQPCRNGGKCIGKSKCKCPKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCREGWHGRHCNKRYGASLMHAPRPAGAGLERHTPSLKKAEDRRDPPESNYIWVEHHHHHH
• Endotoxin: < 1.0 EU/μg of protein (determined by LAL method)
• Purity: > 90 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: 20 mM MES (pH 5.5) containing 1 mM DTT, 1 mM PMSF, 30 % glycerol.

Gene Information

• Gene Name: Wif1 Wnt inhibitory factor 1 [ Mus musculus (house mouse) ]
• Official Symbol: Wif1
• Synonyms: Wif1; Wnt inhibitory factor 1; WIF-; WIF-1; AW107799; wnt inhibitory factor 1
• Gene ID: 24117
• mRNA Refseq: NM_011915
• Protein Refseq: NP_036045
• UniProt ID: Q9WUA1