Recombinant Mouse Ush2A protein, His-tagged
Cat.No. : | Ush2A-4322M |
Product Overview : | Recombinant Mouse Ush2A protein(Q2QI47)(265-517aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 265-517aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GRMQDFRLYNVSLTNREILEVFSGDFPHLHIQPHCRCPGSHPRVHPSVQQYCIPNGAGDTPEHRMSRLNPEAHPLSFINDDDVATSWISHVFTNITQLYEGVAISIDLENGQYQVLKVITQFSSLQPVAIRIQRKKADSSPWEDWQYFARNCSVWGMKDNEDLENPNSVNCLQLPDFIPFSHGNVTFDLLTSGQKHRPGYNDFYNSSVLQEFMRATQIRLHFHGQYYPAGHTVDWRHQYYAVDEIIVSGRCQC |
Gene Name | Ush2a Usher syndrome 2A (autosomal recessive, mild) homolog (human) [ Mus musculus ] |
Official Symbol | Ush2A |
Synonyms | USH2A; Usher syndrome 2A (autosomal recessive, mild) homolog (human); usherin; usher syndrome type-2A protein homolog; usher syndrome type IIa protein homolog; Gm676; Gm983; Mush2a; Usherin; A930011D15Rik; A930037M10Rik; |
Gene ID | 22283 |
mRNA Refseq | NM_021408 |
Protein Refseq | NP_067383 |
◆ Recombinant Proteins | ||
USH2A-6464R | Recombinant Rat USH2A Protein | +Inquiry |
Ush2A-4322M | Recombinant Mouse Ush2A protein, His-tagged | +Inquiry |
Ush2A-6473M | Recombinant Mouse Ush2A protein, His-tagged | +Inquiry |
USH2A-9942M | Recombinant Mouse USH2A Protein, His (Fc)-Avi-tagged | +Inquiry |
USH2A-17894M | Recombinant Mouse USH2A Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ush2A Products
Required fields are marked with *
My Review for All Ush2A Products
Required fields are marked with *
0
Inquiry Basket