Recombinant Mouse tumor necrosis factor receptor superfamily member 14 protein, His&Fc tagged

• Cat.No.: Tnfrsf14-01M
• Product Overview: Recombinant mouse HVEM/TNFRSF14 (39-206 aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: Baculovirus
• Tag: Fc&His
• Protein Length: 39-206 aa
• Description: Predicted to enable cytokine binding activity and ubiquitin protein ligase binding activity. Acts upstream of or within several processes, including defense response to bacterium; negative regulation of alpha-beta T cell proliferation; and positive regulation of macromolecule metabolic process. Located in external side of plasma membrane. Is expressed in liver lobe. Orthologous to human TNFRSF14 (TNF receptor superfamily member 14).
• Tag: C-hIgG-His
• Form: Liquid
• Molecular Mass: 45.3 kDa (407aa)
• AA Sequence: QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQ< LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH>
• Endotoxin: < 1.0 EU/μg of the protein by the LAL method.
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
• References: 1. Choi EK., et al. (2013) J Endocrinol. 220:25-33.
  2. Kotsiou E., et al. (2018) Blood. 128:72-81.

Gene Information

• Gene Name: Tnfrsf14 tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator) [ Mus musculus (house mouse) ]
• Official Symbol: Tnfrsf14
• Synonyms: Tnfrsf14; tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator); TR2; Atar; HveA; Hvem; Tnfrs14; tumor necrosis factor receptor superfamily member 14; herpes virus entry mediator A; herpesvirus entry mediator A; tumor necrosis factor receptor-like 2
• Gene ID: 230979
• mRNA Refseq: NM_178931
• Protein Refseq: NP_849262
• UniProt ID: Q80WM9