Recombinant Mouse Tslp protein, FC-tagged

• Cat.No.: Tslp-469M
• Product Overview: Recombinant Mouse Tslp(Gln67-Ser225) fused with FC tag at C-terminal was expressed in HEK293.

Specification

• Source: HEK293
• Species: Mouse
• Tag: FC
• Form: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4
• Protein length: Gln67-Ser225
• AA Sequence: YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDK TFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPEVDDIEGRMD EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 21 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 19X PBS.Please aliquot the reconstituted solution.
• Shipping: The product is shipped at ambient temperature.

Gene Information

• Gene Name: Tslp thymic stromal lymphopoietin [ Mus musculus ]
• Official Symbol: Tslp
• Synonyms: TSLP; thymic stromal lymphopoietin; thymic stroma-derived lymphopoietin
• Gene ID: 53603
• mRNA Refseq: NM_021367
• Protein Refseq: NP_067342
• UniProt ID: Q9JIE6
• Chromosome Location: 18 B1; 18 18.12 Cm
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem
• Function: cytokine activity