Recombinant Mouse TNMD Protein (51-317 aa), His-tagged

• Cat.No.: TNMD-2659M
• Product Overview: Recombinant Mouse TNMD Protein (51-317 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Source: Yeast
• Species: Mouse
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 34.1 kDa
• Protein length: 51-317 aa
• AA Sequence: KHFWPEVSKKTYDMEHTFYSNGEKKKIYMEIDPITRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLIAVSELQDFEEDGEDLHFPTSEKKGIDQNEQWVVPQVKVEKTRHTRQASEEDLPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRV
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Tnmd tenomodulin [ Mus musculus ]
• Official Symbol: TNMD
• Synonyms: TNMD; tenomodulin; mTeM; mChM1L; tendin; myodulin; TeM; ChM1L; 1110017I01Rik
• Gene ID: 64103
• mRNA Refseq: NM_022322
• Protein Refseq: NP_071717
• UniProt ID: Q9EP64