Recombinant Human TNMD Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TNMD-3952H
Product Overview : TNMD MS Standard C13 and N15-labeled recombinant protein (NP_071427) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein that is related to chondromodulin-I, which is a cartilage-specific glycoprotein that functions to stimulate chondrocyte growth and to inhibit tube formation of endothelial cells. This protein is also an angiogenesis inhibitor. Genetic variation in this gene is associated with a risk for type 2 diabetes, central obesity and serum levels of systemic immune mediators in a body size-dependent manner. This gene is also a candidate gene for age-related macular degeneration, though a direct link has yet to be demonstrated.
Molecular Mass : 37 kDa
AA Sequence : MAKNPPENCEDCHILNAEAFKSKKICKSLKICGLVFGILTLTLIVLFWGSKHFWPEVPKKAYDMEHTFYSSGEKKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLISVSELQDFEEEGEDLHFPANEKKGIEQNEQWVVPQVKVEKTRHARQASEEELPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TNMD tenomodulin [ Homo sapiens (human) ]
Official Symbol TNMD
Synonyms TNMD; tenomodulin; BRICD4; ChM1L; myodulin; TEM; tendin; hTeM; hChM1L; chondromodulin-IB; BRICHOS domain containing 4; chondromodulin-1-like protein; chondromodulin-I-like protein; CHM1L;
Gene ID 64102
mRNA Refseq NM_022144
Protein Refseq NP_071427
MIM 300459
UniProt ID Q9H2S6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TNMD Products

Required fields are marked with *

My Review for All TNMD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon