Recombinant Mouse TNFSF4 Protein, Fc-tagged

Description :	Enables tumor necrosis factor receptor binding activity. Involved in several processes, including T cell activation; regulation of gene expression; and regulation of lymphocyte activation. Acts upstream of or within cholesterol metabolic process; inflammatory response; and negative regulation of cytokine production. Predicted to be located in cell surface. Predicted to be active in extracellular space. Is expressed in sensory organ and skeleton. Used to study primary pulmonary hypertension and type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in myocardial infarction. Orthologous to human TNFSF4 (TNF superfamily member 4).
Source :	HEK293
Species :	Mouse
Tag :	Fc
Form :	Lyophilized
Molecular Mass :	44.5 kDa
Protein length :	198
AA Sequence :	MEGEGVQPLDENLENGSRPRFKWKKTLRLVVSGIKGAGMLLCFIYVCLQLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
Purity :	> 98%
Applications :	WB; ELISA; FACS; FC
Stability :	This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage :	At -20 centigrade.
Concentration :	1 mg/mL
Storage Buffer :	PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution :	Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Name	Tnfsf4 tumor necrosis factor (ligand) superfamily, member 4 [ Mus musculus (house mouse) ]
Official Symbol	TNFSF4
Synonyms	TNFSF4; tumor necrosis factor (ligand) superfamily, member 4; tumor necrosis factor ligand superfamily member 4; OX40 ligand; atherosclerosis 1; tax-transcriptionally activated glycoprotein 1 ligand; Ath1; gp34; Ath-1; Ox40l; TXGP1; CD134L; OX-40L; Txgp1l;
Gene ID	22164
mRNA Refseq	NM_009452
Protein Refseq	NP_033478
UniProt ID	P43488

ACE2-735H	Recombinant Human ACE2 Protein, His-tagged	+Inquiry
FGF10-15H	Active Recombinant Human FGF10 protein	+Inquiry
KITLG-19H	Active Recombinant Human KITLG Protein, Pre-aliquoted	+Inquiry
DEFB1-17H	Active Recombinant Human DEFB1 protein(1-47aa)	+Inquiry
DEFB4-18H	Active Recombinant Human DEFB4 protein(1-50aa)	+Inquiry