Recombinant Mouse Tnfsf15 Protein, His-tagged

• Cat.No.: Tnfsf15-124M
• Product Overview: Recombinant Mouse Tnfsf15 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Description: Predicted to enable death receptor binding activity. Predicted to be involved in activation of cysteine-type endopeptidase activity involved in apoptotic process and positive regulation of cytokine production. Predicted to act upstream of or within activation of NF-kappaB-inducing kinase activity. Predicted to be located in plasma membrane. Used to study inflammatory bowel disease 16. Orthologous to human TNFSF15 (TNF superfamily member 15).
• Source: E. coli
• Species: Mouse
• Tag: His
• Form: 50mM Tris, 0.3 M NaCl, pH 8.0.
• Molecular Mass: 21.7 kDa
• AA Sequence: MHHHHHHENLYFQGITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL
• Endotoxin: <1EU/ug
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.9 mg/ml

Gene Information

• Gene Name: Tnfsf15 tumor necrosis factor (ligand) superfamily, member 15 [ Mus musculus (house mouse) ]
• Official Symbol: Tnfsf15
• Synonyms: Tl1; Tl1a; Vegi; Tnlg1b
• Gene ID: 326623
• mRNA Refseq: NM_177371
• Protein Refseq: NP_796345
• UniProt ID: Q5UBV8