Recombinant Mouse Tnfsf15 Protein, His-tagged
Cat.No. : | Tnfsf15-124M |
Product Overview : | Recombinant Mouse Tnfsf15 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Predicted to enable death receptor binding activity. Predicted to be involved in activation of cysteine-type endopeptidase activity involved in apoptotic process and positive regulation of cytokine production. Predicted to act upstream of or within activation of NF-kappaB-inducing kinase activity. Predicted to be located in plasma membrane. Used to study inflammatory bowel disease 16. Orthologous to human TNFSF15 (TNF superfamily member 15). |
Form : | 50mM Tris, 0.3 M NaCl, pH 8.0. |
Molecular Mass : | 21.7 kDa |
AA Sequence : | MHHHHHHENLYFQGITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL |
Endotoxin : | <1EU/ug |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.9 mg/ml |
Gene Name | Tnfsf15 tumor necrosis factor (ligand) superfamily, member 15 [ Mus musculus (house mouse) ] |
Official Symbol | Tnfsf15 |
Synonyms | Tl1; Tl1a; Vegi; Tnlg1b |
Gene ID | 326623 |
mRNA Refseq | NM_177371 |
Protein Refseq | NP_796345 |
UniProt ID | Q5UBV8 |
◆ Recombinant Proteins | ||
TNFSF15-150H | Recombinant Human TNFSF15 Trimer protein, N-His-Flag-tagged | +Inquiry |
TNFSF15-0741M | Active Recombinant Mouse TNFSF15 protein, His-tagged | +Inquiry |
Tnfsf15-403M | Recombinant Mouse Tnfsf15 protein, hFc-tagged | +Inquiry |
TNFSF15-1830R | Recombinant Rhesus Monkey TNFSF15 Protein, hIgG1-tagged | +Inquiry |
TNFSF15-4874R | Recombinant Rhesus monkey TNFSF15 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF15-1386RCL | Recombinant Rat TNFSF15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tnfsf15 Products
Required fields are marked with *
My Review for All Tnfsf15 Products
Required fields are marked with *
0
Inquiry Basket