Recombinant Mouse Tnf Protein

Cat.No. : Tnf-7357M
Product Overview : Recombinant mouse TNFa protein without tag was expressed in E. coli and purified by using conventional chromatography.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. Members of this family are classified based on primary sequence, function, and structure. This protein is synthesized as a type-II transmembrane protein and is reported to be cleaved into products that exert distinct biological functions. It plays an important role in the innate immune response as well as regulating homeostasis but is also implicated in diseases of chronic inflammation. In mouse deficiency of this gene is associated with defects in response to bacterial infection, with defects in forming organized follicular dendritic cell networks and germinal centers, and with a lack of primary B cell follicles. Alternative splicing results in multiple transcript variants.
Source : E. coli
Species : Mouse
Form : Liquid
Molecular Mass : 17.4 kDa
Protein length : 80-235
AA Sequence : MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Purity : > 95 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by Bradford assay)
Storage Buffer : PBS, pH 7.4
Gene Name Tnf tumor necrosis factor [ Mus musculus (house mouse) ]
Official Symbol Tnf
Synonyms Tnf; tumor necrosis factor; DI; Tn; DIF; TNF-; Tnfa; Tnfs; TNF-a; TNFSF2; Tnlg1f; Tnfsf1a; TNFalpha; TNF-alpha; tumor necrosis factor; cachectin; tumor necrosis factor ligand 1f; tumor necrosis factor ligand superfamily member 2; tumor necrosis factor-alpha
Gene ID 21926
mRNA Refseq NM_001278601
Protein Refseq NP_001265530
UniProt ID P06804

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Tnf Products

Required fields are marked with *

My Review for All Tnf Products

Required fields are marked with *

0

Inquiry Basket

cartIcon