Recombinant Full Length Bovine Tumor Necrosis Factor(Tnf) Protein, His-Tagged
Cat.No. : | RFL20611BF |
Product Overview : | Recombinant Full Length Bovine Tumor necrosis factor(TNF) Protein (Q06599) (1-234aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-234) |
Form : | Lyophilized powder |
AA Sequence : | MSTKSMIRDVELAEEVLSEKAGGPQGSRSCLCLSLFSFLLVAGATTLFCLLHFGVIGPQREEQSPGGPSINSPLVQTLRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TNF |
Synonyms | TNF; TNFA; TNFSF2; Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a) [Cleaved into: Tumor necrosis factor; membrane form; N-terminal fragment; NTF); Intracellular domain 1; ICD1); Intracellular domain 2 |
UniProt ID | Q06599 |
◆ Recombinant Proteins | ||
PARA-0562B | Recombinant Bacillus subtilis PARA protein, His-tagged | +Inquiry |
MRRF-6512HF | Recombinant Full Length Human MRRF Protein, GST-tagged | +Inquiry |
Slit3-493M | Recombinant Mouse Slit3 protein, His-sumo & myc tagged | +Inquiry |
SEC23A-2563H | Recombinant Human SEC23A, His-tagged | +Inquiry |
TGIF1-4324H | Recombinant Human TGIF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
IgG1-225H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
Collagen-319H | Native Human Collagen Type II | +Inquiry |
S100A11-3111H | Native Human S100A11 protein(Met1-Thr105) | +Inquiry |
LDL-185H | Native Human Low Density Lipoprotein, acetylated, DiI | +Inquiry |
NEFM-179B | Native bovine NEFM | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGEF7-8729HCL | Recombinant Human ARHGEF7 293 Cell Lysate | +Inquiry |
NUDT6-3642HCL | Recombinant Human NUDT6 293 Cell Lysate | +Inquiry |
ARAF-105HCL | Recombinant Human ARAF cell lysate | +Inquiry |
DKC1-6916HCL | Recombinant Human DKC1 293 Cell Lysate | +Inquiry |
LIN7A-4730HCL | Recombinant Human LIN7A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNF Products
Required fields are marked with *
My Review for All TNF Products
Required fields are marked with *
0
Inquiry Basket