Recombinant Mouse Tnf Protein
Cat.No. : | Tnf-140M |
Product Overview : | Purified recombinant protein of Mouse tumor necrosis factor (Tnf) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. Members of this family are classified based on primary sequence, function, and structure. This protein is synthesized as a type-II transmembrane protein and is reported to be cleaved into products that exert distinct biological functions. It plays an important role in the innate immune response as well as regulating homeostasis but is also implicated in diseases of chronic inflammation. In mouse deficiency of this gene is associated with defects in response to bacterial infection, with defects in forming organized follicular dendritic cell networks and germinal centers, and with a lack of primary B cell follicles. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 16.4 kDa |
AA Sequence : | MDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | Tnf tumor necrosis factor [ Mus musculus (house mouse) ] |
Official Symbol | Tnf |
Synonyms | Tnf; tumor necrosis factor; DIF; Tnfa; TNF-a; TNFSF2; Tnlg1f; Tnfsf1a; TNFalpha; TNF-alpha; tumor necrosis factor; cachectin; tumor necrosis factor ligand 1f; tumor necrosis factor ligand superfamily member 2; tumor necrosis factor-alpha |
Gene ID | 21926 |
mRNA Refseq | NM_013693 |
Protein Refseq | NP_038721 |
UniProt ID | P06804 |
◆ Recombinant Proteins | ||
TNF-235H | Recombinant Human TNF protein, His/S-tagged | +Inquiry |
TNF-716B | Active Recombinant Bovine TNF Protein | +Inquiry |
Tnf-016T | Active Recombinant Mouse Tnf Protein (157 aa) | +Inquiry |
TNF-0806H | Recombinant Human TNF protein, Fc-tagged | +Inquiry |
TNF-5525P | Recombinant Porcine Tumor Necrosis Factor | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNF-897HCL | Recombinant Human TNF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tnf Products
Required fields are marked with *
My Review for All Tnf Products
Required fields are marked with *
0
Inquiry Basket