Recombinant Mouse Tlr7 protein, His & MYC-tagged
Cat.No. : | Tlr7-835M |
Product Overview : | Recombinant Mouse Tlr7(NP_001277684.1)(27-348aa) fused with N-terminal 10xHis-tag and C-terminal Myc-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 27-348aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.8 kDa |
AA Sequence : | FRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIPEGIPTNTTNLTLTINHIPSISPDSFRRLNHLEEIDLRCNCVPVLLGSKANVCTKRLQIRPGSFSGLSDLKALYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKENLTELVNIETLYLGQNCYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTLPPNLLELYLYNNIIKKIQENDFNNLNELQVLDLSGNCPRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHSNSLQHVPPTWFKNMRNLQELDLSQNYLAREIEEAKFLHFLPNLVELDFS |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tlr7 toll-like receptor 7 [ Mus musculus (house mouse) ] |
Official Symbol | Tlr7 |
Synonyms | Tlr7; Toll-like receptor 7 |
Gene ID | 170743 |
mRNA Refseq | NM_001290755.1 |
Protein Refseq | NP_001277684.1 |
UniProt ID | P58681 |
◆ Recombinant Proteins | ||
TLR7-3590H | Recombinant Human TLR7 protein, His&Myc-tagged | +Inquiry |
TLR7-1880C | Recombinant Chicken TLR7 | +Inquiry |
TLR7-4550R | Recombinant Rhesus Macaque TLR7 Protein, His (Fc)-Avi-tagged | +Inquiry |
TLR7-3953H | Active Recombinant Human TLR7 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
Tlr7-836M | Recombinant Mouse Tlr7 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TLR7-903HB | Recombinant Human TLR7 Protein, His tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLR7-1043HCL | Recombinant Human TLR7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tlr7 Products
Required fields are marked with *
My Review for All Tlr7 Products
Required fields are marked with *
0
Inquiry Basket