Recombinant Mouse Tigit Protein
Cat.No. : | Tigit-730M |
Product Overview : | Recombinant Mouse Tigit protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Protein Length : | 241 |
Description : | Enables signaling receptor binding activity. Acts upstream of or within negative regulation of T cell activation. Predicted to be active in cell surface. Orthologous to human TIGIT (T cell immunoreceptor with Ig and ITIM domains). |
Form : | Lyophilized |
Molecular Mass : | 14.8 kDa |
AA Sequence : | MHGWLLLVWVQGLIQAAFLATGATAGTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLGGTMAAVLGLICLMVTGVTVLARKKSIRMHSIESGLGRTEAEPQEWNLRSLSSPGSPVQTQTAPAGPCGEQAEDDYADPQEYFNVLSYRSLESFIAVSKTG |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Tigit T cell immunoreceptor with Ig and ITIM domains [ Mus musculus (house mouse) ] |
Official Symbol | Tigit |
Synonyms | TIGIT; T cell immunoreceptor with Ig and ITIM domains; T-cell immunoreceptor with Ig and ITIM domains; V-set and transmembrane domain containing 3; V-set and transmembrane domain-containing protein 3; Vstm3; ENSMUSG00000071552; |
Gene ID | 100043314 |
mRNA Refseq | NM_001146325 |
Protein Refseq | NP_001139797 |
UniProt ID | https://www.uniprot.org/uniprot/A0A0B4J1G6 |
◆ Recombinant Proteins | ||
Tigit-7407M | Recombinant Mouse Tigit, Fc tagged | +Inquiry |
TIGIT-23H | Recombinant Human TIGIT Protein | +Inquiry |
Tigit-1440M | Recombinant Mouse Tigit protein, His & T7-tagged | +Inquiry |
TIGIT-0803M | Active Recombinant Mouse TIGIT protein, His-tagged | +Inquiry |
TIGIT-121C | Active Recombinant Cynomolgus/Rhesus macaque TIGIT protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIGIT-2610HCL | Recombinant Human TIGIT cell lysate | +Inquiry |
TIGIT-1420MCL | Recombinant Mouse TIGIT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tigit Products
Required fields are marked with *
My Review for All Tigit Products
Required fields are marked with *
0
Inquiry Basket