Recombinant Mouse Thy1 protein, His-SUMO-tagged

• Cat.No.: Thy1-3580M
• Product Overview: Recombinant Mouse Thy1 protein(P01831)(20-131aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 20-131aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 28.8 kDa
• AA Sequence: QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Thy1 thymus cell antigen 1, theta [ Mus musculus ]
• Official Symbol: Thy1
• Synonyms: THY1; thymus cell antigen 1, theta; thy-1 membrane glycoprotein; Thy 1.2; thy-1 antigen; T25; CD90; Thy-1; Thy1.1; Thy1.2; Thy-1.2
• Gene ID: 21838
• mRNA Refseq: NM_009382
• Protein Refseq: NP_033408