Recombinant Mouse Tgfb1 Protein, His-tagged

• Cat.No.: Tgfb1-7348M
• Product Overview: Recombinant mouse TGFB1 protein, fused to His-tag at N-terminus, was expressed in E. coli.

Specification

• Description: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. This encoded protein regulates cell proliferation, differentiation and growth, and can modulate expression and activation of other growth factors including interferon gamma and tumor necrosis factor alpha. Mice lacking a functional copy of this gene develop severe multifocal inflammatory disease, yolk sac defects and colon cancer.
• Source: E. coli
• Species: Mouse
• Tag: His
• Form: Liquid
• Molecular Mass: 15 kDa
• Protein length: 279-390
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
• Purity: > 85 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.25 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Tris-HCl (pH 8.0) containing 10 % glycerol.

Gene Information

• Gene Name: Tgfb1 transforming growth factor, beta 1 [ Mus musculus (house mouse) ]
• Official Symbol: Tgfb1
• Synonyms: Tgfb1; transforming growth factor, beta 1; Tgfb; Tgfb-1; TGFbeta; TGF-beta; TGFbeta1; TGF-beta1; transforming growth factor beta-1 proprotein
• Gene ID: 21803
• mRNA Refseq: NM_011577
• Protein Refseq: NP_035707
• UniProt ID: P04202