Recombinant Mouse Tff2 protein, His-tagged

• Cat.No.: Tff2-01M
• Product Overview: Recombinant Mouse Tff2 fused with His tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Form: 20mM Tris-HCl, pH 8.0, 100mM NaCl.
• Molecular Mass: (Theoretical molecular weight)~13kDa including His tag.
• AA Sequence: MNHKVHHHHHHMEKPSPCRCSRLTPHNRKNCGFPGITSEQCFDLGCCFDSSVAGVPWCFHPLPNQESEQCVMEVSARKNCGYPGISPEDCASRNCCFSNLIFEVPWCFFPQSVEDCHY
• Purity: > 90% as determined by SDS-PAGE
• Storage: Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20~-80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.51 mg/ml

Gene Information

• Gene Name: Tff2 trefoil factor 2 (spasmolytic protein 1) [ Mus musculus ]
• Official Symbol: Tff2
• Synonyms: TFF2; trefoil factor 2 (spasmolytic protein 1); trefoil factor 2; spasmolytic polypeptide; SP; mSP
• Gene ID: 21785
• mRNA Refseq: NM_009363
• Protein Refseq: NP_033389
• UniProt ID: Q9QX97
• Chromosome Location: 17 A3.3; 17 15.8 cM
• Function: CXCR4 chemokine receptor binding