Recombinant Mouse TCF7 Protein, His-tagged

• Cat.No.: TCF7-120M
• Product Overview: Recombinant Mouse TCF7 Protein, fused to His-tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: This gene encodes a transcription factor which is a member of the T-cell specific transcription factor family. The encoded protein is distinct from the hepatic transcription factor, transcription factor 1, which is also referred to by the symbol Tcf1. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
• Form: Supplied as a 0.2 μm filtered solution in 25mM Tris, 0.3M NaCl, 0.1 mM EDTA, 50% glycerol,1 mM PMSF, pH 7.4.
• Molecular Mass: ~33.8 kDa
• AA Sequence: MYKETVYSAFNLLMPYPPASGAGQHPQPQPPLHNKPGQPPHGVPQLSPLYEHFSSPHPTPAPADISQKQGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPAPTAAPGAPYPRFTHPSLMLGSGVPGHPAAIPHPAIVPSSGKQELQPYDRNLKTQAEPKAEKEAKKPVIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVLLE
• Endotoxin: <1EU/ug
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.15 mg/ml

Gene Information

• Gene Name: Tcf7 transcription factor 7, T cell specific [ Mus musculus (house mouse) ]
• Official Symbol: TCF7
• Synonyms: Tcf1; TCF-1; AI465550
• Gene ID: 21414
• mRNA Refseq: NM_001313981
• Protein Refseq: NP_001300910
• UniProt ID: Q00417