Recombinant Mouse Sult1a1 protein, His&Myc-tagged

• Cat.No.: Sult1a1-3543M
• Product Overview: Recombinant Mouse Sult1a1 protein(P52840)(1-291aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Mouse
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 39 kDa
• Protein length: 1-291aa
• AA Sequence: MEPLRKPLVPVKGIPLIKYFAETMEQLQNFTAWPDDVLISTYPKSGTNWMSEIMDMIYQGGKLDKCGRAPVYARIPFLEFSCPGVPPGLETLKETPAPRIIKTHLPLSLLPQSLLDQKIKVIYVARNAKDVVVSYYNFYKMAKLHPDPGTWESFLENFMDGKVSYGSWYQHVKEWWELRRTHPVLYLFYEDMKENPKREIKKILEFLGRSLPEETVDLIVHHTSFKKMKENPMANYTTIPTEVMDHTIYPFMRKGTIGDWKNTFTVAQSEHFDAHYAKLMTGCDFTFRCQI
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Sult1a1 sulfotransferase family 1A, phenol-preferring, member 1 [ Mus musculus ]
• Official Symbol: Sult1a1
• Synonyms: SULT1A1; sulfotransferase family 1A, phenol-preferring, member 1; sulfotransferase 1A1; ST1A4; mSTp1; sulfokinase; aryl sulfotransferase; phenol sulfotransferase; arylsulfotransferase ST1A4; phenol/aryl sulfotransferase; sulfotransferase, phenol preferring 1; PST; Stp; Stp1; ST1A1; AI266890
• Gene ID: 20887
• mRNA Refseq: NM_133670
• Protein Refseq: NP_598431