Recombinant Human SULT1A1 protein, His-tagged

Cat.No. : SULT1A1-2830H
Product Overview : Recombinant Human SULT1A1 protein(1-295 aa), fused to His tag, was expressed in E. coli.
Availability April 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-295 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SULT1A1 sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 [ Homo sapiens ]
Official Symbol SULT1A1
Synonyms SULT1A1; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1; STP, STP1; sulfotransferase 1A1; P PST; ts-PST; P-PST 1; aryl sulfotransferase 1; thermostable phenol sulfotransferase1; phenol-sulfating phenol sulfotransferase 1; PST; STP; STP1; P-PST; ST1A1; ST1A3; TSPST1; HAST1/HAST2; MGC5163; MGC131921;
Gene ID 6817
mRNA Refseq NM_001055
Protein Refseq NP_001046
MIM 171150
UniProt ID P50225

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SULT1A1 Products

Required fields are marked with *

My Review for All SULT1A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon