Recombinant Mouse Srpx2 Protein, His-SUMO/MYC-tagged
| Cat.No. : | Srpx2-1376M |
| Product Overview : | Recombinant Mouse Srpx2 Protein (26-468aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E. coli |
| Species : | Mouse |
| Tag : | His&Myc&SUMO |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 70.5 kDa |
| AA Sequence : | WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPRWCYTLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRKSVQCLPSRRWSGTAYCRQIRCHTLPFITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPILKPPQHGYLTCSSAGDNYGAICEYHCDGGYERQGTPSRVCQSSRQWSGTPPVCTPMKINVNVNSAAGLLDQFYEKQRLLIVSAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSAGIIEELRQFQRLTRSYFNMVLIDKQGIDRERYMEPVTPEEIFTFIDDYLLSNEELARRVEQRDLCE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Protein length : | 26-468 a.a. |
| Gene Name | Srpx2 sushi-repeat-containing protein, X-linked 2 [ Mus musculus (house mouse) ] |
| Official Symbol | Srpx2 |
| Synonyms | SRP; SRPUL; 1110039C07Rik; Srpx2 |
| Gene ID | 68792 |
| mRNA Refseq | NM_026838.4 |
| Protein Refseq | NP_081114.2 |
| UniProt ID | Q8R054 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Srpx2 Products
Required fields are marked with *
My Review for All Srpx2 Products
Required fields are marked with *
0
Inquiry Basket
