Recombinant Human SRPX2 protein, GST-tagged

• Cat.No.: SRPX2-20H
• Product Overview: Recombinant Human SRPX2(1 a.a. - 465 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: This gene encodes a secreted protein that contains three sushi repeat motifs. The encoded protein may play a role in the development of speech and language centers in the brain. This protein may also be involved in angiogenesis. Mutations in this gene are the cause of bilateral perisylvian polymicrogyria, rolandic epilepsy, speech dyspraxia and mental retardation.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 79.4 kDa
• Protein length: 1 a.a. - 465 a.a.
• AA Sequence: MASQLTQRGALFLLFFLTPAVTPTWYAGSGYYPDESYNEVYAEEVPQAPALDYRVPRWCYTLNIQDGEATCYSPK GGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFITSGTYTCTNGVLLDSRCDYSCS SGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRG PEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGATCEYHCDGGYDRQG TPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRH VTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLS NQELTQRREQRDICE
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: SRPX2 sushi-repeat containing protein, X-linked 2 [ Homo sapiens ]
• Official Symbol: SRPX2
• Synonyms: SRPX2; sushi-repeat containing protein, X-linked 2; sushi repeat containing protein, X linked 2; sushi repeat-containing protein SRPX2; SRPUL; sushi-repeat-containing protein, X-linked 2; sushi-repeat protein up-regulated in leukemia; BPP; CBPS; PMGX; RESDX
• Gene ID: 27286
• mRNA Refseq: NM_014467
• Protein Refseq: NP_055282
• MIM: 300642
• UniProt ID: O60687
• Chromosome Location: Xq21.33-q23
• Pathway: protein binding; receptor binding
• Function: SRPX2;sushi-repeat containing protein, X-linked 2;sushi repeat containing protein, X linked 2;sushi repeat-containing protein SRPX2;SRPUL;sushi-repeat-containing protein, X-linked 2;sushi-repeat protein up-regulated in leukemia;BPP;CBPS;PMGX;RESDX;NP_055282;NM_014467;O60687;OTTHUMP00000023653;HGNC: 30668;Entrez Gene: 27286;Ensembl: ENSG00000102359;OMIM: 300642;UniProtKB: O60687;SRPX2_HUMAN