Recombinant Mouse SPRR2A1 Protein (1-83 aa), His-tagged

• Cat.No.: SPRR2A1-1928M
• Product Overview: Recombinant Mouse SPRR2A1 Protein (1-83 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-83 aa
• Description: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 13.4 kDa
• AA Sequence: MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Sprr2a1 small proline-rich protein 2A1 [ Mus musculus (house mouse) ]
• Official Symbol: SPRR2A1
• Synonyms: Sprr2a; Sprr2a3
• Gene ID: 20755
• mRNA Refseq: NM_011468
• Protein Refseq: NP_035598
• UniProt ID: Q9CQK8