Recombinant Mouse Sost Protein, His-tagged
| Cat.No. : | Sost-010M |
| Product Overview : | Recombinant mouse SOST/Sclerostin, fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation. |
| Source : | HEK293 |
| Species : | Mouse |
| Tag : | His |
| Form : | Liquid |
| Molecular Mass : | 21.9 kDa |
| AA Sequence : | QGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY |
| Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
| Purity : | > 90% by SDS-PAGE |
| Applications : | SDS-PAGE |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -89 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 0.25 mg/mL (determined by Absorbance at 280nm) |
| Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| Gene Name | Sost sclerostin [ Mus musculus (house mouse) ] |
| Official Symbol | Sost |
| Synonyms | Sost; sclerostin; 5430411E23Rik; sclerostin |
| Gene ID | 74499 |
| mRNA Refseq | NM_024449 |
| Protein Refseq | NP_077769.4 |
| UniProt ID | Q99P68 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sost Products
Required fields are marked with *
My Review for All Sost Products
Required fields are marked with *
0
Inquiry Basket
