Recombinant Mouse Sod2 Protein, His-tagged
| Cat.No. : | Sod2-7342M |
| Product Overview : | Recombinant mouse Sod2, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems. |
| Source : | E. coli |
| Species : | Mouse |
| Tag : | His |
| Form : | Liquid |
| Molecular Mass : | 24.6 kDa |
| Protein length : | 25-222 |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNATEEKYHEALAKGDVTTQVALQPALKFNGGGHINHTIFWTNLSPKGGGEPKGELLEAIKRDFGSFEKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYTACKK |
| Purity : | > 95 % by SDS-PAGE |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
| Concentration : | 1.0 mg/mL (determined by bradford assay) |
| Storage Buffer : | In Phosphate buffered saline (pH7.4) containing 10 % glycerol, 1 mM DTT. |
| Gene Name | Sod2 superoxide dismutase 2, mitochondrial [ Mus musculus (house mouse) ] |
| Official Symbol | Sod2 |
| Synonyms | Sod2; superoxide dismutase 2, mitochondrial; Mn; Sod; MnSOD; Sod-2; superoxide dismutase [Mn], mitochondrial; manganese SOD; manganese superoxide dismutase; EC 1.15.1.1 |
| Gene ID | 20656 |
| mRNA Refseq | NM_013671 |
| Protein Refseq | NP_038699 |
| UniProt ID | P09671 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sod2 Products
Required fields are marked with *
My Review for All Sod2 Products
Required fields are marked with *
0
Inquiry Basket
