Recombinant Human SOD2 Protein, N-His-tagged

Cat.No. : SOD2-062H
Product Overview : Recombinant human SOD2 protein with N-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 222
Description : This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 1.
Form : Solution
Molecular Mass : 24.4 kDa
AA Sequence : MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Purity : > 95%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : 4°C
Concentration : 1 mg/mL
Storage Buffer : Tris-HCl (pH 8). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name SOD2 superoxide dismutase 2, mitochondrial [ Homo sapiens (human) ]
Official Symbol SOD2
Synonyms SOD2; superoxide dismutase 2, mitochondrial; superoxide dismutase [Mn], mitochondrial; indophenoloxidase B; Mn superoxide dismutase; mangano-superoxide dismutase; manganese-containing superoxide dismutase; IPOB; MNSOD; MVCD6;
Gene ID 6648
mRNA Refseq NM_000636
Protein Refseq NP_000627
MIM 147460
UniProt ID P04179

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SOD2 Products

Required fields are marked with *

My Review for All SOD2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon