Recombinant Mouse Sirt5 protein, His&Myc-tagged

• Cat.No.: Sirt5-4555M
• Product Overview: Recombinant Mouse Sirt5 protein(Q8K2C6)(37–310aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Mouse
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 37.6 kDa
• Protein length: 37–310aa
• AA Sequence: SSNMADFRKCFANAKHIAIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPQAFARNPSQVWEFYHYRREVMRSKEPNPGHLAIAQCEARLRDQGRRVVVITQNIDELHRKAGTKNLLEIHGTLFKTRCTSCGTVAENYRSPICPALAGKGAPEPETQDARIPVDKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELALCDLCLVVGTSSVVYPAAMFAPQVASRGVPVAEFNMETTPATDRFRFHFPGPCGKTLPEALAPHETERTS
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Sirt5 sirtuin 5 (silent mating type information regulation 2 homolog) 5 (S. cerevisiae) [ Mus musculus ]
• Official Symbol: Sirt5
• Synonyms: SIRT5; sirtuin 5 (silent mating type information regulation 2 homolog) 5 (S. cerevisiae); NAD-dependent lysine demalonylase and desuccinylase sirtuin-5, mitochondrial; SIR2-like protein 5; NAD-dependent deacetylase sirtuin-5; AV001953; 0610012J09Rik; 1500032M05Rik
• Gene ID: 68346
• mRNA Refseq: NM_178848
• Protein Refseq: NP_849179