Recombinant Mouse Sfrp2 Protein, His-tagged

• Cat.No.: Sfrp2-008M
• Product Overview: Recombinant mouse sFRP-2, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: Insect cells
• Tag: His
• Description: Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP2 may be important for eye retinal development and for myogenesis.
• Form: Liquid
• Molecular Mass: 32.1 kDa
• AA Sequence: LFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKTKNEDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -87 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: 20mM Tris-HCl buffer (pH 8.0) containing 100mM NaCl, 20% glycerol

Gene Information

• Gene Name: Sfrp2 secreted frizzled-related protein 2 [ Mus musculus (house mouse) ]
• Official Symbol: Sfrp2
• Synonyms: Sfrp2; secreted frizzled-related protein 2; Sdf; Sdf5; AI851596; secreted frizzled-related protein 2; SARP-1; sFRP-2; secreted apoptosis-related protein 1; secreted frizzled-related sequence protein 2; secreted frizzled-related sequence protein 5; stromal cell derived factor 5
• Gene ID: 20319
• mRNA Refseq: NM_009144
• Protein Refseq: NP_033170.1
• UniProt ID: P97299