Recombinant Mouse Sell Protein, His-tagged

• Cat.No.: Sell-5756M
• Product Overview: Purified recombinant protein of Mouse selectin, lymphocyte (Sell), transcript variant 1 with a C-His tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Description: Calcium-dependent lectin that mediates cell adhesion by binding to glycoproteins on neighboring cells. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia.
• Molecular Mass: 34.1 kDa
• AA Sequence: WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYNVDHHHHHH
• Endotoxin: < 0.1 ng/μg of protein (< 1 EU/μg)
• Purity: > 95% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: LyopH ilized from a 0.2 μM filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1×PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: Sell selectin, lymphocyte [ Mus musculus (house mouse) ]
• Official Symbol: Sell
• Synonyms: SELL; selectin, lymphocyte; L-selectin; LAM-1; LECAM1; lymphocyte antigen 22; lymph node homing receptor; leukocyte adhesion molecule 1; CD62 antigen-like family member L; lymphocyte surface MEL-14 antigen; leukocyte-endothelial cell adhesion molecule 1; Lnhr; CD62L; Ly-22; Lyam1; Ly-m22; Lyam-1; LECAM-1; AI528707
• Gene ID: 20343
• mRNA Refseq: NM_011346
• Protein Refseq: NP_035476
• UniProt ID: P18337