Recombinant Mouse SDF2L1 Protein (29-211 aa), His-Myc-tagged

• Cat.No.: SDF2L1-2080M
• Product Overview: Recombinant Mouse SDF2L1 Protein (29-211 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Source: Yeast
• Species: Mouse
• Tag: His&Myc
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 24.4 kDa
• Protein length: 29-211 aa
• AA Sequence: SKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Sdf2l1 stromal cell-derived factor 2-like 1 [ Mus musculus ]
• Official Symbol: SDF2L1
• Synonyms: SDF2L1; stromal cell-derived factor 2-like 1; SDF2-like protein 1
• Gene ID: 64136
• mRNA Refseq: NM_022324
• Protein Refseq: NP_071719
• UniProt ID: Q9ESP1