Recombinant Mouse SDF2 Protein (19-211 aa), His-Myc-tagged

• Cat.No.: SDF2-2105M
• Product Overview: Recombinant Mouse SDF2 Protein (19-211 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• ProteinLength: 19-211 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 26.4 kDa
• AA Sequence: SNMAVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKTATVCERGTPIKCGQPIRLTHINTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTDVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLRAEVHHAEL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Sdf2 stromal cell derived factor 2 [ Mus musculus ]
• Official Symbol: SDF2
• Synonyms: SDF2; stromal cell derived factor 2; SDF-2; AI853825; MGC107120
• Gene ID: 20316
• mRNA Refseq: NM_009143
• Protein Refseq: NP_033169
• UniProt ID: Q9DCT5