Recombinant Mouse SAP130 Protein (845-1057 aa), His-tagged

• Cat.No.: SAP130-1948M
• Product Overview: Recombinant Mouse SAP130 Protein (845-1057 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 845-1057 aa
• Description: Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 26.8 kDa
• AA Sequence: PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Sap130 Sin3A associated protein [ Mus musculus ]
• Official Symbol: SAP130
• Synonyms: SAP130; Sin3A associated protein; 6720406D06; 2610304F09Rik
• Gene ID: 269003
• mRNA Refseq: NM_172965
• Protein Refseq: NP_766553
• UniProt ID: Q8BIH0