Recombinant Mouse SAMHD1 Protein (395-626 aa), His-tagged

• Cat.No.: SAMHD1-796M
• Product Overview: Recombinant Mouse SAMHD1 Protein (395-626 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Description: Host restriction nuclease that blocks early-stage virus replication in dendritic and other myeloid cells. Likewise, suppresses LINE-1 retrotransposon activity. May function by reducing the cellular dNTP levels to levels too low for retroviral reverse transcription to occur. May play a role in mediating proinflammatory responses to TNF-alpha signaling.
• Source: E. coli
• Species: Mouse
• Tag: His
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 30.6 kDa
• Protein length: 395-626 aa
• AA Sequence: DIMITDAFLKADPYVEITGTAGKKFRISTAIDDMEAFTKLTDNIFLEVLHSTDPQLSEAQSILRNIECRNLYKYLGETQPKREKIRKEEYERLPQEVAKAKPEKAPDVELKAEDFIVDVINVDYGMEDKNPIDRVHFYCKSNSKQAVRINKEQVSQLLPEKFAEQLIRVYCKKKDGKSLDAAGKHFVQWCALRDFTKPQDGDIIAPLITPLKWNNKTSSCLQEVSKVKTCLK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: Samhd1 SAM domain and HD domain, 1 [ Mus musculus ]
• Official Symbol: SAMHD1
• Synonyms: SAMHD1; Mg11; E330031J07Rik
• Gene ID: 56045
• mRNA Refseq: NM_001139520
• Protein Refseq: NP_001132992
• UniProt ID: Q60710