Recombinant Human S100A7A Protein (2-101 aa), His-tagged
Cat.No. : | S100A7A-1686H |
Product Overview : | Recombinant Human S100A7A Protein (2-101 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-101 aa |
Description : | May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 13.2 kDa |
AA Sequence : | SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | S100A7A S100 calcium binding protein A7A [ Homo sapiens ] |
Official Symbol | S100A7A |
Synonyms | S100A7A; protein S100-A7A; S100A7f; NICE-2; S100A15; S100A7L1; |
Gene ID | 338324 |
mRNA Refseq | NM_176823 |
Protein Refseq | NP_789793 |
UniProt ID | Q86SG5 |
◆ Recombinant Proteins | ||
S100A7A-229H | Recombinant Human S100A7A Protein, MYC/DDK-tagged | +Inquiry |
S100A7A-4567H | Recombinant Human S100 Calcium Binding Protein A7A, His-tagged | +Inquiry |
S100A7A-4760H | Recombinant Human S100A7A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
S100A7A-1686H | Recombinant Human S100A7A Protein (2-101 aa), His-tagged | +Inquiry |
S100A7A-7867M | Recombinant Mouse S100A7A Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100A7A Products
Required fields are marked with *
My Review for All S100A7A Products
Required fields are marked with *
0
Inquiry Basket