Recombinant Mouse S100a6 Protein, His-tagged

• Cat.No.: S100a6-7326M
• Product Overview: Recombinant mouse S100A6 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-89
• Description: May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.
• Form: Liquid
• Molecular Mass: 12.2 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK
• Purity: > 95 %
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer.
  Avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Tris-HCl buffer (pH 8.0) containing 1 mM DTT, 30 % glycerol, 100 mM NaCl

Gene Information

• Gene Name: S100a6 S100 calcium binding protein A6 (calcyclin) [ Mus musculus (house mouse) ]
• Official Symbol: S100a6
• Synonyms: S100a6; S100 calcium binding protein A6 (calcyclin); 2A; 2A9; Cac; PRA; 5B10; CALC; Cacy; CALCYCLIN; protein S100-A6; S100 calcium-binding protein A6; calcium binding protein A6 (calcyclin); prolactin receptor-associated protein
• Gene ID: 20200
• mRNA Refseq: NM_011313
• Protein Refseq: NP_035443
• UniProt ID: P14069